SDF-1α (CXCL12) labelled 15N for Mass Spectometry and NMR (5 µg) [HM-163]

260.00 

Description

SDF-1α (CXCL12) labelled 15N for Mass Spectometry and NMR (5 µg) [HM-163]

SDF-1α for Mass Spectrometry is the 8 kDa protein uniformly labelled with isotope 15N.
This protein is suitable for Mass Spectrometry and NMR studies.
This product corresponds to the human sequence and is produced in E.coli using a media in which the only source of nitrogen come from 15NH4Cl.
SDF-1α we provide is the natural protein, with no tags or additional amino acids.

It has the sequence:

MKPVSLSYRCPCRFFESHVARANVKHLKILNTPNCALQIVARLKNNNRQVCIDPKLKWIQEYLEKALNK

Molecular Mass: Stromal Cell-Derived Factor 1α (SDF-1α, CXCL12) consists of 69 amino acid residues and has a calculated molecular mass of approximately 8 kDA
Purity: The purified protein is >95% homogeneous (electrophoresis and mass spectrometry). It contains no nucleic acids.
Endotoxin Level: The purified protein is free from LPS (Cambrex Limulus Amoebocyte Assay QCL-1000, <0.1 ng LPS per mg protein).
Buffer: Stromal Cell-Derived Factor 1α (SDF-1α, CXCL12) is lyophilized from DPBS without Ca and Mg.
Storage: 2-8°C when lyophilized. The protein once reconstituted with water can be stored frozen (-20°C). Avoid repeated freezing and thawing.

This product is intended for research only, and cannot be used on humans.

 

SDF-1α labelled 15N for Mass Spectometry and NMR Datasheet

Reviews

There are no reviews yet.

Be the first to review “SDF-1α (CXCL12) labelled 15N for Mass Spectometry and NMR (5 µg) [HM-163]”

Your email address will not be published. Required fields are marked *